CDS

Accession Number TCMCG083C18666
gbkey CDS
Protein Id KMZ74566.1
Location join(224456..224458,224667..224755,224853..224934,225029..225082)
Organism Zostera marina
locus_tag ZOSMA_125G00290

Protein

Length 75aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA41721, BioSample:SAMN00991190
db_source LFYR01000277.1
Definition Cytochrome c oxidase, subunit Vib family protein [Zostera marina]
Locus_tag ZOSMA_125G00290

EGGNOG-MAPPER Annotation

COG_category C
Description This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport
KEGG_TC 3.D.4.11,3.D.4.8
KEGG_Module M00154        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
KEGG_ko ko:K02267        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00190        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04260        [VIEW IN KEGG]
ko04714        [VIEW IN KEGG]
ko04932        [VIEW IN KEGG]
ko05010        [VIEW IN KEGG]
ko05012        [VIEW IN KEGG]
ko05016        [VIEW IN KEGG]
map00190        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04260        [VIEW IN KEGG]
map04714        [VIEW IN KEGG]
map04932        [VIEW IN KEGG]
map05010        [VIEW IN KEGG]
map05012        [VIEW IN KEGG]
map05016        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005507        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005739        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006970        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0009628        [VIEW IN EMBL-EBI]
GO:0009651        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043167        [VIEW IN EMBL-EBI]
GO:0043169        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046872        [VIEW IN EMBL-EBI]
GO:0046914        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGATTGACATAAAAACTGCTCCAGCAGACTTCCGTTTCCCCACGACAAATCAAACCAGACACTGTTTCACCCGCTACATTGAGTTCCACAAATGTTTGGCGGCAAAGGGTGAAGAATCTGGTGAATGTGAAAAGTATGCAAGCTACTATCGTTCTCTCTGCCCGATTGAATGGGTTGAACGATGGAATGAGCAAAGGGAAAATGGAAACTTCCCTGGACCTTTGTGA
Protein:  
MIDIKTAPADFRFPTTNQTRHCFTRYIEFHKCLAAKGEESGECEKYASYYRSLCPIEWVERWNEQRENGNFPGPL